PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31710.2.p
Common NameBRADI_2g31710, LOC100824282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 656aa    MW: 72002 Da    PI: 7.6178
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31710.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.63.8e-26337388152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isle++++yFs+++k+AAk+Lgvc+T++KriCR++GI+ WP+R i+++
  Bradi2g31710.2.p 337 AEKTISLEVIQQYFSGSLKSAAKSLGVCPTTMKRICRKHGIPHWPSREISKV 388
                       589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.109327408IPR003035RWP-RK domain
PfamPF020424.7E-23340388IPR003035RWP-RK domain
SuperFamilySSF542773.92E-23551643No hitNo description
SMARTSM006664.4E-25560643IPR000270PB1 domain
PROSITE profilePS5174521.29560643IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.8E-24561642No hitNo description
CDDcd064071.82E-30561642No hitNo description
PfamPF005649.1E-17561642IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MKSCIGVVEL IMTSKKVNYA SEVDKVCKAL EAVNLKSTKI VEHPCVQICN ESRQVALVEI  60
LEILTVVCEE FKLPLGQTWV PCKYQSLLAH GGVKRSCLSF GGSCMEEVCI STSDVAFHII  120
DARMWGFRDA CVAHHLQKGQ GVSGKAFISG RPCFSKDVSR FSKMEYPLVH YARMFALAGC  180
FSIYLQSAYT GDDYILEFFL PPDCREDDEQ KALLQSIIVL LRQHLRTLQV AGDKGLNEAC  240
LQVDAVTVMH NEETGNTYVQ DLNVGGGIHT LLESDMHGGI HESDNRNHKA STMSKNHLLS  300
HDYSGDKPVA IPSGSGTSDS SLLYKNKKNP VRRRGKAEKT ISLEVIQQYF SGSLKSAAKS  360
LGVCPTTMKR ICRKHGIPHW PSREISKVNK SISKLKEVIE SAQASESAFG FTSVTAPPFG  420
PASSSYLLDI DKSRQEKTAE VYIPFGNEHK ASSSQKSLQN CSPSILISPQ TLLANSVIQI  480
EGDKVTNLRS SSGQHSTNSQ TSEGSYPGSQ GNGAFVRESI ASTFLEPQQN LYNSQGFAKD  540
SVRPTVLSPG RMMSPQNSGI VTVKAHYKED ILRFRFPCSG SLRTLKDEVA KRIQIDVIGS  600
FYIKYLDDDH EWVNLTCQAD LEECMEIYLL SGLNVLRLLV TDNAVILGSS HGSSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753898.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0Q3R0L40.0A0A0Q3R0L4_BRADI; Uncharacterized protein
STRINGBRADI2G31710.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-164Nin-like family protein